SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011969778.1.7720 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011969778.1.7720
Domain Number 1 Region: 94-242
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 9.17e-35
Family Reductases 0.019
Further Details:      
 
Domain Number 2 Region: 235-356
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.7e-27
Family 2Fe-2S ferredoxin-related 0.021
Further Details:      
 
Domain Number 3 Region: 2-105
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.11e-26
Family Ferredoxin reductase FAD-binding domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011969778.1.7720
Sequence length 358
Comment MULTISPECIES: phenylacetic acid degradation protein [Sinorhizobium]; AA=GCF_000427485.1; RF=na; TAX=935563; STAX=382; NAME=Sinorhizobium meliloti WSM4191; strain=WSM4191; AL=Scaffold; RT=Major
Sequence
MARFHPLQVTEVRRETRDAVVVTLEPRDEDRAAFDFTQGQYLTFRRIFDGEELRRSYSIC
SGLGEGALRVGIKRVDGGCFSNWANEVLKPGDTLEAMPPMGTFFVPVEPEVSRHYLGFAG
GSGITPVLSLVKTVLAREPRSAFTLVYANRHFSSIMFREELDDLKNLYLGRLSVLHILES
EAQDIDLFSGRLDLEKCTALFRHWIDVKSADIAFICGPEPMMQAVAATLRAHGVSDSRIR
FELFGSSQPGRARRRTASPAGTDGGSRCEATVTLDGATRSFTLPKRGQSLLEAALENRMD
APYACKAGVCSSCRAKVLEGEVEMESNNALEDYEVEQGYVLMCQSYPLSDRVVVSYDE
Download sequence
Identical sequences A6UH26
WP_011969778.1.29075 WP_011969778.1.61285 WP_011969778.1.7720 YP_001312889.1.44884 gi|150376293|ref|YP_001312889.1| 366394.Smed_4151 gi|150376293|ref|YP_001312889.1|NC_009620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]