SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011969835.1.61285 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011969835.1.61285
Domain Number 1 Region: 19-249
Classification Level Classification E-value
Superfamily Aromatic compound dioxygenase 3.27e-80
Family Aromatic compound dioxygenase 0.0000000668
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011969835.1.61285
Sequence length 253
Comment MULTISPECIES: protocatechuate 3,4-dioxygenase subunit beta [Sinorhizobium]; AA=GCF_000419785.1; RF=na; TAX=1041150; STAX=110321; NAME=Sinorhizobium medicae WSM244; strain=WSM244; AL=Contig; RT=Major
Sequence
MSGDQSGGENDRPETGAFFARDRAWHPPAFAPGYKSSVLRSPQKALLSLDGTLSEITGPV
FGHSMLGELDNDLIHNFAKPGESAIGERIIVHGRVLDERGRPVQDALVEFWQANAGGRYR
HRKESYLAALDPNFGGCGRAITNGDGHYCFRTVKPGAYPWPNGVNDWRPAHIHFSIFGHG
FAQRLITQMYFEGDPMIWKCPIVGAIPDRRAIEQLIAALDWGNTVPMDARAYKFDIVLRG
RRSTFFENRPEGN
Download sequence
Identical sequences A6UH83
gi|150376350|ref|YP_001312946.1| gi|150376350|ref|YP_001312946.1|NC_009620 366394.Smed_4208 WP_011969835.1.29075 WP_011969835.1.31871 WP_011969835.1.61285 WP_011969835.1.7720 WP_011969835.1.89664 YP_001312946.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]