SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011970763.1.7720 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011970763.1.7720
Domain Number 1 Region: 113-256
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.17e-33
Family Flavohemoglobin, C-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 248-363
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.97e-27
Family 2Fe-2S ferredoxin-related 0.02
Further Details:      
 
Domain Number 3 Region: 21-122
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 9.68e-23
Family Ferredoxin reductase FAD-binding domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011970763.1.7720
Sequence length 364
Comment MULTISPECIES: hybrid-cluster NAD(P)-dependent oxidoreductase [Sinorhizobium]; AA=GCF_000427485.1; RF=na; TAX=935563; STAX=382; NAME=Sinorhizobium meliloti WSM4191; strain=WSM4191; AL=Scaffold; RT=Major
Sequence
MRRVKWLRSEQMTQFKQLSFWSDAEPLECVTRTPEAPNVVTFSFQSPSGALFNHDPGQFV
TLELPAPGGPLYRTYTISSAPSRPTALTITVKAQDGSTGTRWMLDNLHKGMRIRASGPAG
KFSIVHHPADKYLFISAGSGITPMVAMTTWLYDSGREPDIVFINCARRPSEIILRDRIEL
MASRIVGIDLKWVVEEPDPFRPWTGYRGIFNQIMLGLIAQDYLEREVFCCGAEPFMRAVR
EALAGLGFDMDRYHQESFTAEPAHAEDVPEDVVPDEQNQAEIAFALSGITAKCKETDSIL
AAAKAVGLVIPSGCAMGICGTCKVRKTEGQVHMVHNGGITDEDVEDGYILACCSKPLGRV
SVEA
Download sequence
Identical sequences A6ULX5
366394.Smed_5978 WP_011970763.1.7720 YP_001314588.1.44884 gi|150377993|ref|YP_001314588.1|NC_009621 gi|150377993|ref|YP_001314588.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]