SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011974394.1.7720 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011974394.1.7720
Domain Number 1 Region: 4-242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.22e-84
Family ABC transporter ATPase domain-like 0.000000135
Further Details:      
 
Domain Number 2 Region: 236-357
Classification Level Classification E-value
Superfamily MOP-like 5.83e-27
Family ABC-transporter additional domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011974394.1.7720
Sequence length 359
Comment MULTISPECIES: ABC transporter ATP-binding protein [Sinorhizobium]; AA=GCF_000427485.1; RF=na; TAX=935563; STAX=382; NAME=Sinorhizobium meliloti WSM4191; strain=WSM4191; AL=Scaffold; RT=Major
Sequence
MTAIALRQIRKTYGSLQVIHDVDIDIESGEFLVLVGPSGCGKSTLLRMIAGLEEISGGIL
DIGGKVVNALPPSDRDIAMVFQDYALYPHMSVRENMAFGLKMRGTDDETIEKRVSHAAGI
LKIQPFLDRRPAQLSGGQRQRVAMGRAIVREPSAFLFDEPLSNLDAALRVEMRLEIAKLH
NRMKATTVYVTHDQVEAMTLADRIVVLNAGKIEQIGPPLDLYHRPASLFVARFIGSPTMN
TLPAKVVSDGGGSAIRLKERTLQLVGWSGQPIRAGEVTFGIRPEDLVVCRPEDAWFSGEL
AVAERLGSQTYGYVEIGEERMLTVEFPRSTPIRVGEPIHVRPNMEAIHLFDTATGLRKT
Download sequence
Identical sequences A6U5W2
WP_011974394.1.29075 WP_011974394.1.7720 YP_001325877.1.44884 366394.Smed_0183 gi|150395410|ref|YP_001325877.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]