SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011974630.1.89664 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011974630.1.89664
Domain Number 1 Region: 45-149
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000126
Family Nitrogenase iron protein-like 0.054
Further Details:      
 
Weak hits

Sequence:  WP_011974630.1.89664
Domain Number - Region: 262-305
Classification Level Classification E-value
Superfamily Urease, beta-subunit 0.00301
Family Urease, beta-subunit 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011974630.1.89664
Sequence length 346
Comment MULTISPECIES: tetraacyldisaccharide 4'-kinase [Sinorhizobium]; AA=GCF_000378785.1; RF=na; TAX=935558; STAX=110321; NAME=Sinorhizobium medicae WSM1115; strain=WSM1115; AL=Scaffold; RT=Major
Sequence
MVSEAPPFWWTKADWRAYALWPFSWLYGRIAGMRMDRARRATSAVPLICIGNFTVGGAGK
TPTAIAIARAAKARGLKPAFLSRGYGGSLDVTTLVDPEHHRARDVGDEPLLLAREALTVI
CRRRVDGARKLAAEGADIIIMDDGFQSARLVFDFALIVVDSGRGIGNGHLVPSGPVRAPI
GNQLRHATALLKLGHGSAADPVVRRASRAGKPVYVAETVRIDEGSLVGVKVLAWAGIADT
EKFFKTVRETGAIIEETRSFPDHHHFSEDEIADLIDRATSRGYTLVTTAKDIVRLEPGHG
RAGELAAKSRVIEIEVRFDDPAAPGKIIDAALASARARRLREHKSG
Download sequence
Identical sequences A6U6K3
gi|150395651|ref|YP_001326118.1| WP_011974630.1.29075 WP_011974630.1.31871 WP_011974630.1.61285 WP_011974630.1.7720 WP_011974630.1.89664 YP_001326118.1.44884 366394.Smed_0426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]