SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011975055.1.89664 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011975055.1.89664
Domain Number 1 Region: 30-155
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.57e-46
Family Translational machinery components 0.0000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011975055.1.89664
Sequence length 155
Comment MULTISPECIES: 30S ribosomal protein S9 [Sinorhizobium]; AA=GCF_000378785.1; RF=na; TAX=935558; STAX=110321; NAME=Sinorhizobium medicae WSM1115; strain=WSM1115; AL=Scaffold; RT=Major
Sequence
MADLSALKDIATTAEPAAPVHVKKVDAQGRSYATGKRKDAVARVWIKPGSGKITVNGKPF
SDYFARPVLQMILQQPVVAAARDGQFDIDATVAGGGLSGQAGAVRHGISKALTYFEPGLR
AVLKRGGFLTRDSRVVERKKYGRAKARRSFQFSKR
Download sequence
Identical sequences A6U7T6
WP_011975055.1.29075 WP_011975055.1.31871 WP_011975055.1.61285 WP_011975055.1.7720 WP_011975055.1.89664 YP_001326551.1.44884 366394.Smed_0861 gi|150396084|ref|YP_001326551.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]