SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011975068.1.7720 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011975068.1.7720
Domain Number 1 Region: 597-772
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.34e-58
Family ATP-dependent protease Lon (La), catalytic domain 0.000000688
Further Details:      
 
Domain Number 2 Region: 316-589
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-51
Family Extended AAA-ATPase domain 0.0005
Further Details:      
 
Domain Number 3 Region: 15-204
Classification Level Classification E-value
Superfamily PUA domain-like 1.44e-47
Family LON domain-like 0.0000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011975068.1.7720
Sequence length 806
Comment MULTISPECIES: endopeptidase La [Sinorhizobium]; AA=GCF_000427485.1; RF=na; TAX=935563; STAX=382; NAME=Sinorhizobium meliloti WSM4191; strain=WSM4191; AL=Scaffold; RT=Major
Sequence
MTNKTSPATESATYPVLPLRDIVVFPHMIVPLFVGREKSIRALEEVMGTDKQIMLVTQIN
ATDDDPEPSAIYKVGTIANVLQLLKLPDGTVKVLVEGRSRAEIERYTPRDDFYEAMAHAL
PEPDEDPVEIEALSRSVVSEFESYVKLNKKISPEVVGVASQIEDYSKLADTVASHLSIKI
VEKQEMLETTSVKMRLEKALGFMEGEISVLQVEKRIRSRVKRQMEKTQREYYLNEQMKAI
QKELGDSEDGRDEMAELEERISKTKLSKEAREKADAELKKLRQMSPMSAEATVVRNYLDW
LLGLPWGKKSKIKTDLNHAEKVLDTDHFGLDKVKERIVEYLAVQARSSKIKGPILCLVGP
PGVGKTSLAKSIAKATGREYIRMALGGVRDEAEIRGHRRTYIGSMPGKVVQSMKKAKKSN
PLFLLDEIDKMGQDFRGDPSSALLEVLDPEQNSTFMDHYLEVEYDLSNVMFITTANTLNI
PPPLMDRMEVIRIAGYTEEEKLEIAKRHLLPKAIRDHALQTNEFSVTDGALTAIIQNYTR
EAGVRNFERELMKLARKAVTEILKGKTKKVEVSAENINDYLGVPRFRHGEAERDDQVGVV
TGLAWTEVGGELLTIEGVMMPGKGRMTVTGNLRDVMKESISAAASYVRSRAIDFGIEPPL
FDKRDIHVHVPEGATPKDGPSAGVAMATAIVSVMTGIPISKDVAMTGEITLRGRVLPIGG
LKEKLLAALRGGIKKVLIPEENAKDLADIPDNVKNSLEIIPVSRMGEVIAHALLRLPEPI
EWDPASQPAALPSVDSQDEAGTSIAH
Download sequence
Identical sequences A6U7U9
gi|150396097|ref|YP_001326564.1| 366394.Smed_0874 WP_011975068.1.29075 WP_011975068.1.31871 WP_011975068.1.61285 WP_011975068.1.7720 WP_011975068.1.89664 YP_001326564.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]