SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011975161.1.31871 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011975161.1.31871
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 5.89e-38
Family N-utilization substance G protein NusG, N-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 120-176
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.35e-18
Family N-utilization substance G protein NusG, C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011975161.1.31871
Sequence length 176
Comment MULTISPECIES: transcription termination/antitermination protein NusG [Sinorhizobium]; AA=GCF_000372345.1; RF=na; TAX=1041149; STAX=110321; NAME=Sinorhizobium medicae WSM1369; strain=WSM1369; AL=Contig; RT=Major
Sequence
MAARWYIVHAYSNFEKKVAESIEEKARQKGLTHLFEKILVPTEKVVEIRRGRKVDAERKF
FPGYVLVRADLTDEAYHLIKNTPKVTGFLGTDSKPVPIPDHEADRILGQVQDGVERPKPS
ISFEIGEQVRVSDGPFASFNGIVQDVDEERSRLKVEVSIFGRATPVELEYGQVEKV
Download sequence
Identical sequences A6U846
gi|150396194|ref|YP_001326661.1| WP_011975161.1.29075 WP_011975161.1.31871 WP_011975161.1.61285 WP_011975161.1.7720 WP_011975161.1.89664 YP_001326661.1.44884 366394.Smed_0973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]