SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011975255.1.29075 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011975255.1.29075
Domain Number 1 Region: 2-208
Classification Level Classification E-value
Superfamily SGNH hydrolase 7.63e-27
Family TAP-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011975255.1.29075
Sequence length 213
Comment MULTISPECIES: arylesterase [Sinorhizobium]; AA=GCF_000419665.1; RF=na; TAX=1041148; STAX=110321; NAME=Sinorhizobium medicae DI28; strain=DI28; AL=Contig; RT=Major
Sequence
MKTVLCYGDSLTWGFDAVGSGRHALEDRWPSVLQKGLGSGTHVIAEGLNGRTTAYDDHLA
DCDRNGARVLPTVLHTHAPLDLIVIMLGSNDMKPIIHGTAFGAVKGIERLVNLVRRHDWP
TPGEDGPDILIVSPPPLCETANSAFAAMFAGGVEQSAMLAPLYRDLADELDCGFFDGGSV
ARTSPIDGVHLDAENTRAIGRGLEPVVRMMLGL
Download sequence
Identical sequences A6U8F1
WP_011975255.1.29075 WP_011975255.1.7720 YP_001326766.1.44884 366394.Smed_1079 gi|150396299|ref|YP_001326766.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]