SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011975401.1.7720 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011975401.1.7720
Domain Number 1 Region: 32-175,204-497
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.83e-104
Family Arylsulfatase 0.00000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011975401.1.7720
Sequence length 554
Comment MULTISPECIES: sulfatase [Sinorhizobium]; AA=GCF_000427485.1; RF=na; TAX=935563; STAX=382; NAME=Sinorhizobium meliloti WSM4191; strain=WSM4191; AL=Scaffold; RT=Major
Sequence
MNRRIICGVGALAASTVLWGALAPVQAQETRKPNILFIVSDDTGYGDLGPYGGGEGRGMP
TPNIDKLADEGMTFFSFYAQPSCTPGRAAMQTGRIPNRSGMTTVAFQGEGGGLPAAEWTL
ASVLKRGGYQTYFTGKWHLGEADYALPIAQGYDEMKYVGLYHLNAYTYADATWFPDMDPE
LRAMFQKVTKGSLSGKAGGEVTEDFKINGQYVDTPVIDGKPGVVGIPFFDGYVEKAAIEF
LDAAAKKPDQPFYINVNFMKVHQPNLPAPEFQHKSLSKTKYADSVVELDTRIGRILDKLR
ETGMDRNTLVFYTTDNGAWQDVYPDAGYTPFRGTKGTVREGGNRVPAIAVWPGKIKPSSK
NHDIVGGLDLMATFAAAGGVPLPDKDREDKPIVFDSYDMSPVLLGTGKSARKSWFYFTEN
ELTPGAARVGNYKAVFNLRGDNGQSTGGLAVDSNLGWKGAESYVATVPQVFDLWQDPQER
YDIFMNNYTEHTWTMVSISNAIEELMKTYVQHPPRKLQSESYSGPLTITSYQRFEWARQQ
LGKEGVNIPLPTGN
Download sequence
Identical sequences A6U8V9
gi|150396457|ref|YP_001326924.1| 366394.Smed_1239 WP_011975401.1.61285 WP_011975401.1.7720 YP_001326924.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]