SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011975855.1.89664 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011975855.1.89664
Domain Number 1 Region: 6-245
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.32e-86
Family ABC transporter ATPase domain-like 0.000000828
Further Details:      
 
Domain Number 2 Region: 239-353
Classification Level Classification E-value
Superfamily MOP-like 1.29e-17
Family ABC-transporter additional domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011975855.1.89664
Sequence length 355
Comment MULTISPECIES: ABC transporter ATP-binding protein [Sinorhizobium]; AA=GCF_000378785.1; RF=na; TAX=935558; STAX=110321; NAME=Sinorhizobium medicae WSM1115; strain=WSM1115; AL=Scaffold; RT=Major
Sequence
MMGNAFIHFDNVSKAFGVMTVVDNLELAIQQGEFVSMLGPSGSGKTTLLMMLAGFEAPSS
GSISVKGKRVDALPPYKRNMGVVFQNYALFPHMTVAENVAFPLKMRGVSRSETAERVGKA
LDMVQLGQFHERRPSQLSGGQQQRVALARALVFEPEVVLMDEPLGALDKKLREQMQMDIR
DIHHRLGLTIVFVTHDQAEALTMSDRIAIFNHGKIEQIGKPSEIYDRPTTQFVAEFIGET
NLLSGRVTACRNGLLDVAVEGGQQIKVASTAKFEPGEHVKVSVRPERIELAPAGGSANEL
SVRVSDVVYRGDHLQVIAAAASGPLVVKSTRKASAPRIGDEAVASFSPEQCWIVA
Download sequence
Identical sequences A6UA71
WP_011975855.1.29075 WP_011975855.1.61285 WP_011975855.1.7720 WP_011975855.1.89664 YP_001327386.1.44884 gi|150396919|ref|YP_001327386.1| 366394.Smed_1716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]