SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011976161.1.7720 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011976161.1.7720
Domain Number 1 Region: 257-492
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 1.24e-71
Family Vanillyl-alcohol oxidase-like 0.042
Further Details:      
 
Domain Number 2 Region: 46-251
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.27e-64
Family FAD-linked oxidases, N-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011976161.1.7720
Sequence length 492
Comment MULTISPECIES: lactate dehydrogenase [Sinorhizobium]; AA=GCF_000427485.1; RF=na; TAX=935563; STAX=382; NAME=Sinorhizobium meliloti WSM4191; strain=WSM4191; AL=Scaffold; RT=Major
Sequence
MWVAQGRLFSVLAKVHRETRRRVLVALKSIAAGVRNETGIAAAKTHLAARFGGRFQTGEA
IRAQHAHTTTYIPAQLPDAVVFPESAAEVCEIVEVACAHRVPLIPFGTGSSLEGHLNAPH
GGISVDMMRMNRVLAVSAEDLDCTVEPGVTREELNTYLRDTGLFFPIDPGANASIGGMAS
TRASGTNAVRYGTMKENVLAVTAVVAGGREIRTAHRARKSSAGYDLTRLFVGAEGTLGII
TSITLRLQGIPEVISGGVCPFPTIADACNAVILTIQSGIPVARIELLDALQMKACNAYSG
LSYQETPTLFVEFHGGGQSVELQSRQFAEIASEFGSPGFIWTTNPEERARLWKARHNAYW
AQKSLMPGRAILSTDVCVPISRLADCVAATHEDIAAYGLVAPIVGHAGDGNFHVGLLFDD
TDAADVARAEAFVERLNARALSMDGTCTGEHGIGQGKMPFLAAELGDALDLMRQIKRSLD
PDNIFNPGKIFI
Download sequence
Identical sequences A6UB34
366394.Smed_2031 gi|150397232|ref|YP_001327699.1| WP_011976161.1.7720 YP_001327699.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]