SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011976492.1.31125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011976492.1.31125
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily Homeodomain-like 1.95e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0035
Further Details:      
 
Domain Number 2 Region: 112-190
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000000000178
Family Tetracyclin repressor-like, C-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011976492.1.31125
Sequence length 195
Comment TetR family transcriptional regulator [Methanococcus maripaludis]; AA=GCF_000017225.1; RF=representative genome; TAX=426368; STAX=39152; NAME=Methanococcus maripaludis C7; strain=C7; AL=Complete Genome; RT=Major
Sequence
MTRNLILKKSKELFLEKGYSETSLSEIARACNISKGGIYHHFERKEDLYIETMISILEEN
GKAVISSIENETRFENAIFEAIEQAIIIRTKYINNYNKDCEKTAYFGPVSDAIKKFPEIW
EFNNNIYKNAIDTLVNKIILAQETGEVKKELDPYSVAFHFCSIFEGIHLVSYYTNQKFED
KSRLVISSFWELIKN
Download sequence
Identical sequences A6VFC9
gi|150402012|ref|YP_001329306.1| 426368.MmarC7_0085 WP_011976492.1.31125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]