SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011976601.1.31125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011976601.1.31125
Domain Number 1 Region: 1-214
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.18e-63
Family Phosphate binding protein-like 0.000033
Further Details:      
 
Domain Number 2 Region: 216-287
Classification Level Classification E-value
Superfamily GlnB-like 2.33e-19
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011976601.1.31125
Sequence length 288
Comment ATP phosphoribosyltransferase [Methanococcus maripaludis]; AA=GCF_000017225.1; RF=representative genome; TAX=426368; STAX=39152; NAME=Methanococcus maripaludis C7; strain=C7; AL=Complete Genome; RT=Major
Sequence
MILLALPNKGRISKPVNEILEKAGLKISVHGRSLFAQTVDPEIKVMFARAKDIPEFVRDG
VADVGVTGYDLMLERDTEEELEMLLDFKFGNARLVIAAPENSTVNSIKDVKDGMKIATEF
PGLTKRYLEKKGLNLEIIELSGATEIAPFIGVSDLICDLTSTGTTLQLNRLKEVENVVSS
TTRLVANKKSMEDPEKCAKINQVLSGIKSVLYAQSKRLIMMNAPKDKVSEITSIIPGMGG
PTVSEILSNDKMLAINAVIDENKVFETVTNLEMLGARDILVVPIERIL
Download sequence
Identical sequences A6VFN8
gi|150402121|ref|YP_001329415.1| 426368.MmarC7_0194 WP_011976601.1.31125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]