SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011977410.1.31125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011977410.1.31125
Domain Number 1 Region: 27-320
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.12e-36
Family Extended AAA-ATPase domain 0.034
Further Details:      
 
Domain Number 2 Region: 333-401
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000165
Family TrmB-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011977410.1.31125
Sequence length 408
Comment ATPase AAA [Methanococcus maripaludis]; AA=GCF_000017225.1; RF=representative genome; TAX=426368; STAX=39152; NAME=Methanococcus maripaludis C7; strain=C7; AL=Complete Genome; RT=Major
Sequence
MLDPIEFIHNASSISKKSMNRLKLKTNPFSEKPIRGNTKFFVGRTSELSEIADILGAAQY
GSVANAAIVGTKGIGKSSILNILYYASKRHNHWVVELEASQITARQFLIQLMYGIIKDNL
FSVDGTLSSDYMKHSQKIIEIYKRLSNYSDKTPVHYPREKIERDLKYLLNEVKEENKLCV
ILIDEADQFAKRSCLGLLQFFHSFLYEDDILTFLAGPPTMVEDLTKISPAIRDRIPKIIN
MPPLTKEEAYDLIKRRLEDSQVTGAKGYEPFSEQSIEKIIEECDGIPRRIIMTCSEAVSL
ALKNGVNEINEDIAKNAMKNLGISVGHQILNHLTPAQSKIIKAMAELGGSSTVTELSGIL
NNSTGTIGTHLSDIYEMGYIYKERDGYNVYYTLSKELKDVLITKEDIS
Download sequence
Identical sequences A6VI21
WP_011977410.1.31125 gi|150402954|ref|YP_001330248.1| 426368.MmarC7_1030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]