SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011998065.1.33635 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011998065.1.33635
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 5.23e-22
Family HisE-like (PRA-PH) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011998065.1.33635
Sequence length 102
Comment phosphoribosyl-ATP pyrophosphatase [Ignicoccus hospitalis]; AA=GCF_000017945.1; RF=representative genome; TAX=453591; STAX=160233; NAME=Ignicoccus hospitalis KIN4/I; strain=KIN4/I; AL=Complete Genome; RT=Major
Sequence
MSDFLSELWLVIKKRIEEKPQGSYTAEIVKRGLPFAARKFGEESVELIVASLSEPRDSVI
YEAADVIYHLMVLLALRGVDWAEVIKELERRSRAKSGAGGNS
Download sequence
Identical sequences A8A8G1
453591.Igni_0029 WP_011998065.1.33635 gi|156936824|ref|YP_001434620.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]