SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011998576.1.33635 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011998576.1.33635
Domain Number 1 Region: 180-540
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 8.37e-97
Family Nqo4-like 0.00000206
Further Details:      
 
Domain Number 2 Region: 10-185
Classification Level Classification E-value
Superfamily Nqo5-like 6.02e-33
Family Nqo5-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011998576.1.33635
Sequence length 540
Comment NADH dehydrogenase subunit D [Ignicoccus hospitalis]; AA=GCF_000017945.1; RF=representative genome; TAX=453591; STAX=160233; NAME=Ignicoccus hospitalis KIN4/I; strain=KIN4/I; AL=Complete Genome; RT=Major
Sequence
MNFVGEVERKEWSNALYVEVEPQYWYENAARLKDQGYLFPSMLTAVDWPAEKKVQVFFLV
HRIRDASSVVLSTKVDRENRELPSLSSLYPGVEWHENETYEMFGINFTGHPDYERWGRIR
KLLLSEDPRLFPKDRFPLLKDSGGYKDLPKVNWAEIEGTDQEREGLREDLTYVYVGPQHP
ATHGPVGFLLGLKGEIVEDVIPRLGYVHRGVEWIYEQKEYLKVIPLLDRQCYIDGIGWEW
PYVMALEEIMDVKVDRRAQLLRILAAELSRIQSHLLYIGSFAENVNHLTAFAWTVRDREV
FINLLEMLTGQRMTFNYLRPGGVAFDLPQGFKDVYEKVVARFHKHFEKLIETTLDNPTVA
MRAEGVAQVSAEDAIKYGWSGPNLRASGVAWDLRINKPYGGYDDGIDFEGAVGSVGDNLD
RMLVRFEEIRQSLKIIRQVLRELTERGQNELGTHLKRVPPFPRKPGIAYGYHDSPRGENG
ILLVANPSDPKWRTRPWRVHMRSPVFVHTMSLKYLGKGLLLQDFLAFYISLDTCVAEMDR
Download sequence
Identical sequences A8A9X2
gi|156937335|ref|YP_001435131.1| WP_011998576.1.33635 453591.Igni_0542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]