SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012004651.1.18676 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012004651.1.18676
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.52e-38
Family Frataxin-like 0.00000651
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012004651.1.18676
Sequence length 106
Comment MULTISPECIES: iron donor protein CyaY [Serratia]; AA=GCF_000347995.1; RF=na; TAX=768491; STAX=768491; NAME=Serratia sp. S4; strain=S4; AL=Scaffold; RT=Major
Sequence
MNDSEFHQLADQLMLNIEETLDDFDGDADIDYETNGGVMTLSFENGTKIVINRQEPLHQV
WLATKTGGYHFNYRDGVWLCDRSDRAFYPLLSEAASAQAGEEVKFA
Download sequence
Identical sequences A8G850
gi|157368429|ref|YP_001476418.1| 399741.Spro_0180 WP_012004651.1.18676 WP_012004651.1.35080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]