SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012004651.1.35080 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012004651.1.35080
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.52e-38
Family Frataxin-like 0.00000651
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012004651.1.35080
Sequence length 106
Comment MULTISPECIES: iron donor protein CyaY [Serratia]; AA=GCF_000018085.1; RF=na; TAX=399741; STAX=28151; NAME=Serratia proteamaculans 568; strain=568; AL=Complete Genome; RT=Major
Sequence
MNDSEFHQLADQLMLNIEETLDDFDGDADIDYETNGGVMTLSFENGTKIVINRQEPLHQV
WLATKTGGYHFNYRDGVWLCDRSDRAFYPLLSEAASAQAGEEVKFA
Download sequence
Identical sequences A8G850
gi|157368429|ref|YP_001476418.1| WP_012004651.1.18676 WP_012004651.1.35080 399741.Spro_0180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]