SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012011077.1.28396 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012011077.1.28396
Domain Number 1 Region: 9-130
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.41e-23
Family Voltage-gated potassium channels 0.00087
Further Details:      
 
Domain Number 2 Region: 115-249
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.87e-16
Family Potassium channel NAD-binding domain 0.0048
Further Details:      
 
Weak hits

Sequence:  WP_012011077.1.28396
Domain Number - Region: 287-326
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.0222
Family TrkA C-terminal domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012011077.1.28396
Sequence length 328
Comment potassium channel protein [Bacillus pumilus]; AA=GCF_000017885.4; RF=na; TAX=315750; STAX=1408; NAME=Bacillus pumilus SAFR-032; strain=SAFR-032; AL=Complete Genome; RT=Major
Sequence
MKSNRIFIAWLRWPLYLRIAVIICFLLLFFGQLIVILEPKQYHTIFDGIWWALITVATVG
YGDFVPQTMPGQIAGMALILIGASFVTAYFATLAAAVFSKQHHYVEGKVAFKGKGHLIII
GWNEKTNKLLQSFQTIDPAMPIVLIDDSLKEGPLLENVHFIKGHGTEDGTLRKANISGAD
ALMITADQHENEVTADMQSVLTLLAAKGLNPSLYCLIEILTDRYVKNAERAGANQVIHTS
DAVNHLMVEHFLLKEQFKALQKKRHMTLHKQVTIIPVPASLTGETFLTALHHFLEHHVIV
VGIQKKEGPMLNPPFDYELHPEDELISL
Download sequence
Identical sequences A8FGT7
WP_012011077.1.28396 315750.BPUM_2799 gi|157693552|ref|YP_001488014.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]