SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012013649.1.65288 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012013649.1.65288
Domain Number 1 Region: 4-159
Classification Level Classification E-value
Superfamily YaeB-like 1.96e-39
Family YaeB-like 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012013649.1.65288
Sequence length 163
Comment MULTISPECIES: transcriptional regulator [Salinispora]; AA=GCF_000377085.1; RF=na; TAX=1169195; STAX=168695; NAME=Salinispora tropica CNS416; strain=CNS416; AL=Scaffold; RT=Major
Sequence
MGEAFTVEPIAHVVGGRTEPTDDYWGGVRAIVRIDEKRFTPESAKGLDAFSHLEVVFRFH
LTDPTDLNLGARRPRDNPDWPEVGIFGHRNMRRINWLGVSRCRLLKVDGLDLHVEGLDAV
DSTPVLDIKPWFVEFGPRGEVFQAHWTTDMLGHYFAAQSPRKE
Download sequence
Identical sequences A4X7L8
gi|145594949|ref|YP_001159246.1| 369723.Strop_2421 WP_012013649.1.12452 WP_012013649.1.28039 WP_012013649.1.3277 WP_012013649.1.3377 WP_012013649.1.34286 WP_012013649.1.57249 WP_012013649.1.65288 WP_012013649.1.69032 WP_012013649.1.9676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]