SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012020571.1.27320 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012020571.1.27320
Domain Number 1 Region: 3-167
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.41e-48
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000357
Further Details:      
 
Domain Number 2 Region: 171-277
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 4.06e-32
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012020571.1.27320
Sequence length 278
Comment carbon monoxide dehydrogenase [Metallosphaera sedula]; AA=GCF_001266655.1; RF=na; TAX=43687; STAX=43687; NAME=Metallosphaera sedula; strain=ARS50-1; AL=Complete Genome; RT=Major
Sequence
MYPPKFGYVIPDSVDEANEFLEKHEDAKALAGGHSLIPMLKLRILRPSYLVELKGLNDLH
FIKKEEGKIRIGALTTHYEIVKANLPLLSEAGATVADPQVRNMGTIGGVISHLDPAADYP
ASLIAMDAVVRIKGTRGEREEPFKDFAKDMFSPDLNPGELVKEVIIPGFKGYSFSYKKLE
RRAGDYAIVGVAVLLKKEAGVVKDVRIGLTAVNNKAVRASEAEKVLLDRSPDEKLIEEAA
EKAMSYANPTSDIRGSAEYKKKMTRVMTKRALQDALTR
Download sequence
Identical sequences A0A088E3B1 A4YED2
gi|146303392|ref|YP_001190708.1| WP_012020571.1.15515 WP_012020571.1.27320 WP_012020571.1.28583 WP_012020571.1.31166 WP_012020571.1.34633 WP_012020571.1.8883 WP_012020571.1.99084 399549.Msed_0609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]