SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012021977.1.27320 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012021977.1.27320
Domain Number 1 Region: 4-212
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.18e-52
Family Extended AAA-ATPase domain 0.000000364
Further Details:      
 
Domain Number 2 Region: 225-317
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 9.78e-22
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012021977.1.27320
Sequence length 326
Comment ATPase AAA [Metallosphaera sedula]; AA=GCF_001266655.1; RF=na; TAX=43687; STAX=43687; NAME=Metallosphaera sedula; strain=ARS50-1; AL=Complete Genome; RT=Major
Sequence
MMDEILWAEKYRPRSLDDIVNQRDIVERLKHFVKEKNMPHLLFAGPPGTGKTTSALALVH
DLYGENYEQYLLELNASDERGIDVIRNKVKEFARTVTPGSVPFKTVLLDEADNMTADAQQ
ALRRTMELYTETTRFILACNYLSKIIDPIQSRTALFRFYPLKKEDVISRLEFIMKQEGVQ
YDPKALDVIYDVTNGDMRKAINVLQAASAYGKVTQEAVFKVLGLAQPKEVRDMVKLALQG
RFMDARSKLLSLIINYGLSGEDIVKQVHRDIFSNEYQIPEELRVLLTDYIGEVEFRIIEG
ADDEIQLSAMLAKLALLGQKYLGEKK
Download sequence
Identical sequences A0A088E848 A4YID8
WP_012021977.1.15515 WP_012021977.1.27320 WP_012021977.1.28583 WP_012021977.1.31166 WP_012021977.1.34633 WP_012021977.1.8883 WP_012021977.1.99084 399549.Msed_2050 gi|146304798|ref|YP_001192114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]