SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012038794.1.80587 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012038794.1.80587
Domain Number - Region: 97-154
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000628
Family NfeD domain-like 0.005
Further Details:      
 
Domain Number - Region: 56-82
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0213
Family GHMP Kinase, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012038794.1.80587
Sequence length 162
Comment hypothetical protein [Clavibacter michiganensis]; AA=GCF_000063485.1; RF=na; TAX=443906; STAX=28447; NAME=Clavibacter michiganensis subsp. michiganensis NCPPB 382; strain=NCPPB 382; AL=Complete Genome; RT=Major
Sequence
MIVFVVVGAVGLLLLLCSIVLGDLLDAIGGGDGLVSGVALGAALAIYGVGGVLADQAGIG
SGGAIAVAVALALVALVVVQLTVRFVAKQESGGSYSPVGMVGVVTSPTSPAGGEVRLEHI
RELERRLAMSDAPLAVGTRIRVVSEDGFRVRVEPAADADPTT
Download sequence
Identical sequences A5CSU9
443906.CMM_2104 gi|148273288|ref|YP_001222849.1| WP_012038794.1.80587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]