SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012038953.1.97611 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012038953.1.97611
Domain Number 1 Region: 138-423
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.57e-123
Family Enolase 0.0000000483
Further Details:      
 
Domain Number 2 Region: 4-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.7e-54
Family Enolase N-terminal domain-like 0.00000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012038953.1.97611
Sequence length 426
Comment enolase [Clavibacter michiganensis]; AA=GCF_002151055.1; RF=na; TAX=33013; STAX=28447; NAME=Clavibacter michiganensis subsp. michiganensis; strain=CASJ005; AL=Contig; RT=Major
Sequence
MAAIEAVNAREILDSRGNPTVEVEVLLEDGTFTRAAVPSGASTGAFEAYELRDGDAGRYL
GKGVQKAVAAVVDEIGPAIQDLDAADQRIIDATMIELDGTENKSRLGANALLGVSLAVAK
AAADSAELPLYRYLGGPNAHTLPVPMLNVINGGSHADTNVDIQEFMLLPVGASTFSEGLR
WGVETYHALKSLLKKKGLSTGLGDEGGFAPNLDSNRAALDLLMEAIDAAGFTAGKQIALG
LDVASSEFYSDGAYTFEGQKVDAAHLTAYFADLVASYPLITIEDPLDEDDWAGYDHFTAE
LGAKVQIVGDDLFVTNPKRLADGITRGVANSILVKVNQIGTLTETLDAVSLAQRSGYTTV
LSHRSGETEDTTIADLAVAVDAGQIKTGAPARSERVAKYNQLLRIEQDLGAAAVYAGRSA
FPRFQA
Download sequence
Identical sequences A0A1Y3FDT4 A5CTA8
443906.CMM_2263 gi|148273447|ref|YP_001223008.1| WP_012038953.1.100120 WP_012038953.1.11755 WP_012038953.1.36461 WP_012038953.1.56944 WP_012038953.1.75151 WP_012038953.1.80587 WP_012038953.1.8140 WP_012038953.1.84123 WP_012038953.1.88496 WP_012038953.1.97611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]