SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012054976.1.94621 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012054976.1.94621
Domain Number 1 Region: 11-49
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000313
Family SinR domain-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012054976.1.94621
Sequence length 303
Comment helix-turn-helix domain-containing protein [Haemophilus influenzae]; AA=GCF_002093195.1; RF=na; TAX=727; STAX=727; NAME=Haemophilus influenzae; strain=GE42; AL=Contig; RT=Major
Sequence
MNPTTEQVLSPGEIFRQTRKALNLSLEDVAKEITLRPSILEQLENNEFIQKSTPAIFVKG
YVRSYAKFLRLPDSVWENIVFAETEKNDLGKNARSTRAVNQYSSHNRWIGRLTAIVFVIV
IGMTGLWWWQSYQQNTQERDDLVQSYVASTENNQPTTALVTTEETNKSAPETAAPVSQPV
EITNNLLPEIAQENSVSQPKNDEKSVSDIQSAVENPSISPTLPIAKGDLVIEILANSSWI
SVKDNARHVLAQKEYKQGEILTFNGNEFSLIVGAPSNVRITYKGENYPLKVDGRVAKFKL
SQP
Download sequence
Identical sequences A0A1Q5Y1Y6 A5UGH0
374931.CGSHiGG_04645 gi|148827506|ref|YP_001292259.1| WP_012054976.1.45125 WP_012054976.1.85244 WP_012054976.1.94621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]