SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012061185.1.51202 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012061185.1.51202
Domain Number 1 Region: 437-541
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.2e-17
Family Anti-sigma factor antagonist SpoIIaa 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012061185.1.51202
Sequence length 551
Comment sodium-independent anion transporter [Clostridium beijerinckii]; AA=GCF_000767745.1; RF=na; TAX=864803; STAX=1520; NAME=Clostridium beijerinckii ATCC 35702; strain=SA-1; AL=Complete Genome; RT=Major
Sequence
MMPKFFSMIKNKEITREQVMKDIIAGVIVAVIALPLSIALGISSGVSPEKGLTTAIFAGF
IISLLGGSKVQIGGPTAAFVVIIYSIIQEYGIGGLVVATIMAGIILVIMGILKFGSLIKY
IPQTITIGFTAGIAVTLVSTEVKDFLALKIENVPAEFFAKWKSYLTNIGTLNTWSLIIGI
SCIFIMIFWPKVSKTIPGSMIALIVATIFVKIFNIPVETIGSRFQEISSTLPVPMFPKIN
MDVINKLFAPSITIAILAALESLLSATVADGMISDKHDSNMELIAQGLANITCGIFGGIP
ATGAIARTAANVKSNGRSPISGMVHSITLLATMLILMPLARMIPMSVLSAILIIVAYNMS
QWKVFKSLLKAPKSDVIVLLLTFTCTVIFDLVVAIGIGMIMTMFLFMKRVSDTTEIRDLV
EEKVFDKDTNTVLEKADGRIRVYQVNGPMFFGVVNEFFDKMKEIESSVGVVILDMRHTHA
IDASAIDALTRLLKHCNELNIKLCLTHVQNQPMKVLNKMGFVVKIGVSHIYETKTEAIEK
AYDYVKELEAS
Download sequence
Identical sequences A0A1S8RNG6 A6M3G2
gi|150019844|ref|YP_001312098.1| WP_012061185.1.44456 WP_012061185.1.51202 WP_012061185.1.88565 WP_012061185.1.91641 WP_012061185.1.96201 290402.Cbei_5036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]