SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012061294.1.89664 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012061294.1.89664
Domain Number 1 Region: 32-247
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.78e-27
Family NodB-like polysaccharide deacetylase 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012061294.1.89664
Sequence length 251
Comment MULTISPECIES: polysaccharide deacetylase [Sinorhizobium]; AA=GCF_000378785.1; RF=na; TAX=935558; STAX=110321; NAME=Sinorhizobium medicae WSM1115; strain=WSM1115; AL=Scaffold; RT=Major
Sequence
MLERQSRIGPLVDRLANRAIWKLARSRRLLETDVPLVSFTFDDVPDSALGAGAAVLEKYE
ARGTFYIAGGLAGQVEPDRRLITPEGCGELLARGHEIGCHTFSHRRLRDIAGLGADLDRN
DAYLKRVGVSPGASNFAFPYNAAWPSARAELRRRYRTCRAAGEAINRGAVDPMMLKGVEI
RQPEHEARALTSWIDDVVERPGWLIFFTHDIAMQPTSYGCTPETFDHLVRYAVEKGCCIL
RVDSAADRIGW
Download sequence
Identical sequences A6UHN0
WP_012061294.1.29075 WP_012061294.1.31871 WP_012061294.1.61285 WP_012061294.1.7720 WP_012061294.1.89664 YP_001313093.1.44884 gi|150376497|ref|YP_001313093.1|NC_009620 366394.Smed_4355 gi|150376497|ref|YP_001313093.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]