SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012061794.1.31871 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012061794.1.31871
Domain Number 1 Region: 25-263
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.72e-86
Family ABC transporter ATPase domain-like 0.000000775
Further Details:      
 
Domain Number 2 Region: 258-382
Classification Level Classification E-value
Superfamily MOP-like 0.000000000714
Family ABC-transporter additional domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012061794.1.31871
Sequence length 387
Comment amino acid ABC transporter substrate-binding protein [Sinorhizobium medicae]; AA=GCF_000372345.1; RF=na; TAX=1041149; STAX=110321; NAME=Sinorhizobium medicae WSM1369; strain=WSM1369; AL=Contig; RT=Major
Sequence
MKHATAPAEPAMPVSANRQSERRPFLEISGLWKAYGDFVALRDIDLQVKEGEFVCFLGPS
GCGKTTLLRAIAGLDIQSRGAIRQAGQDISRLPPAQRDYGIVFQSYALFPNLTIEKNIAF
GLENIGRPRREIASRVSDLLDLVGLSSQGRKYPAQLSGGQQQRVALARAMAISPGLLLLD
EPLSALDAKVRVHLRHEIKELQRKLGVTTIMVTHDQEEALSMADRIVVMNQGGIEQVGTP
TEIYRHPRTLFVADFIGETNQFPATVGKGAQVEIGHTRFACAEHLLPAGAAVVAAVRPAD
IIPHGADAHRATGLEAVGNADNLIDAHVEDMEFLGMFWRTRLSAPRLKETPLVADFSTNA
VRRLCIEIGSAIQVEIPQERLLLFAKA
Download sequence
Identical sequences A6UJ32
366394.Smed_4878 gi|150376999|ref|YP_001313595.1| WP_012061794.1.29075 WP_012061794.1.31871 WP_012061794.1.61285 WP_012061794.1.89664 YP_001313595.1.44884 gi|150376999|ref|YP_001313595.1|NC_009620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]