SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012062160.1.32322 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012062160.1.32322
Domain Number 1 Region: 20-435
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.28e-61
Family Phosphate binding protein-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012062160.1.32322
Sequence length 441
Comment carbohydrate ABC transporter substrate-binding protein [Alkaliphilus metalliredigens]; AA=GCF_000016985.1; RF=representative genome; TAX=293826; STAX=208226; NAME=Alkaliphilus metalliredigens QYMF; strain=QYMF; AL=Complete Genome; RT=Major
Sequence
MKRMAKTVAILLALTLLLTACGGGDTPAVDTGGSEEPAGVEEEVVLRFSWWGGDERHEKT
LEAIALFEERNPGVKIEAEYGGWSGFQEKYATQMAGNTAADIMQVNWNWLYIFSKDGNGY
YDLNDLSDYVDLSNYDQAIMDQVTINNKVNALPLGIGAKVFYYNETTYAKAGVEIPKTFE
DLFAAADVFKEQLGNEYYPIDVDAYGAFLMVLYYLEQTTGQPFMNENNEINYTEGQLVEA
LEFYNEMVERGVTPSMQQRAGAGDVPVDQTPSWIQGKYGGTYEWDSAINKFQAALEGEQT
IVTGDYLKDLGSYDSALAKVSMTYAINKDTKHPEIAAQFLNFLVADPDSVALQGTARGIP
ANKAAIETLESMGMLSGLTYEGNVKATQFLGKGINPYFESGELQDLYRELIDQFGYGRIN
AQQTAERLINEVNSMTQELAQ
Download sequence
Identical sequences A6TLQ0
293826.Amet_0896 gi|150388728|ref|YP_001318777.1| WP_012062160.1.32322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]