SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012064937.1.32322 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012064937.1.32322
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.64e-21
Family LysR-like transcriptional regulators 0.0038
Further Details:      
 
Domain Number 2 Region: 91-304
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000000045
Family Phosphate binding protein-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012064937.1.32322
Sequence length 309
Comment LysR family transcriptional regulator [Alkaliphilus metalliredigens]; AA=GCF_000016985.1; RF=representative genome; TAX=293826; STAX=208226; NAME=Alkaliphilus metalliredigens QYMF; strain=QYMF; AL=Complete Genome; RT=Major
Sequence
MELKQLQYFQVCAEQNSLTRAAEILYTTQPNVSMAIRALEKDVGAKLFIRKSKGVELTEC
GRRIYDYAMNVLKNVNLISETGRMSDQMTFSIATNPSSNMAVLFSQFYQKNNSSGIHFRY
TECGAEQMIEMLHDRKYELGFVFVAENKRRALSQILERKHLEFIPLVMTDMVLYVGKENP
LYGRSSILPQELLSLPFAQLEEDYFTINDMLESLMPNQVNGNMLERVMVTNSNHVMIQML
KHTNLCNLGSYWLRDVYRQYDFQRITISGFEEKVMFGYLKARMEPLTPMGKALLSFVEKA
LNEENVNLT
Download sequence
Identical sequences A6TUW4
gi|150391592|ref|YP_001321641.1| WP_012064937.1.32322 293826.Amet_3875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]