SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012068313.1.31125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012068313.1.31125
Domain Number 1 Region: 6-141
Classification Level Classification E-value
Superfamily Resolvase-like 3.01e-45
Family gamma,delta resolvase, catalytic domain 0.0000766
Further Details:      
 
Weak hits

Sequence:  WP_012068313.1.31125
Domain Number - Region: 144-188
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000229
Family Recombinase DNA-binding domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012068313.1.31125
Sequence length 201
Comment recombinase [Methanococcus maripaludis]; AA=GCF_000017225.1; RF=representative genome; TAX=426368; STAX=39152; NAME=Methanococcus maripaludis C7; strain=C7; AL=Complete Genome; RT=Major
Sequence
MPGNEMIFGYARVSTQDQNVDRQLDELKAAGCQKIFYEKISGTKMERPEFLRMLDQVRSG
DLIIITELTRLSRSTKDLLNVVEMLEEKGVSIKSLKESWLDTSSAHGKLLFTFFAGISQF
ERDIISERVKSGLQAARARGRLGGRKPADPKTIDIAVRMWKSKEYSITEILKTCGISRRT
LYKYLKQDEECKKIIEKEILN
Download sequence
Identical sequences A6VK84
426368.MmarC7_1807 gi|150403717|ref|YP_001331011.1| WP_012068313.1.31125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]