SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012079944.1.39695 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012079944.1.39695
Domain Number 1 Region: 163-350
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.1e-71
Family Methylesterase CheB, C-terminal domain 0.000000222
Further Details:      
 
Domain Number 2 Region: 1-107
Classification Level Classification E-value
Superfamily CheY-like 1.01e-28
Family CheY-related 0.00000745
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012079944.1.39695
Sequence length 359
Comment chemotaxis response regulator protein-glutamate methylesterase [Janthinobacterium sp. Marseille]; AA=GCF_000013625.1; RF=na; TAX=375286; STAX=375286; NAME=Janthinobacterium sp. Marseille; strain=Marseille; AL=Complete Genome; RT=Major
Sequence
MKIKVLIVDDSALIRSVMKEIINSQPDMEVVGVAPDPIVARDLIKQTNPDVLTLDVEMPR
MDGLDFLEKLMRLRPMPVVMVSSLTERGSDITLRALELGAVDFVTKPKMSIQSGMLEYTE
LIADKIRTASKARIKSRQITPHDPNKVAGDGVLPLIRNPLTSSEKLIIIGASTGGTEAIK
DFLMQMPSDCPGILITQHMPPGFTKSFAQRLDSLCKISVKESEGGERVLPGHAYLAPGHS
HLQLVRSGANYMTQLDQGPPVNRHRPSVDVLFHSAAVHAGKNAVGVILTGMGKDGALGML
EMKNVGAYNFAQDEASCVVFGMPREAIAVGATHEVGPLNALPGMVLGYLAAHSSRALRV
Download sequence
Identical sequences A6SZT4
gi|152980521|ref|YP_001353781.1| 375286.mma_2091 WP_012079944.1.39695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]