SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012090436.1.85636 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012090436.1.85636
Domain Number 1 Region: 346-431
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.45e-22
Family CorC/HlyC domain-like 0.0000572
Further Details:      
 
Domain Number 2 Region: 201-336
Classification Level Classification E-value
Superfamily CBS-domain pair 1.14e-17
Family CBS-domain pair 0.0061
Further Details:      
 
Weak hits

Sequence:  WP_012090436.1.85636
Domain Number - Region: 81-125
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0942
Family YkuI C-terminal domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012090436.1.85636
Sequence length 438
Comment HlyC/CorC family transporter [Shewanella baltica]; AA=GCF_000017325.1; RF=na; TAX=402882; STAX=62322; NAME=Shewanella baltica OS185; strain=OS185; AL=Complete Genome; RT=Major
Sequence
MSLFDNVMIILCLIGASCFFSMSEIALAASRKIRLRQLADEGDARAEKVLQLQAVPGSFF
TVVQIGLNAVAIMGGIVGESAFRPYFYELLSPLLTDPWLSQLSFILSFVVVTSAFILVAD
LMPKRIAMAMPEPVALAVVGPMSFCIVLLRPLVWFFNGMASGIFKLLQIPTVRNDAITSD
DIYAVMNAGAEAGVLDRGEQQMMENVFEMQTVSVTSAMTARESLVYFLLQDSEEDIKRKI
SEDPHTKFLVCDGQLDMIKGFVDAKELLIRVINGENITLKGSNLVHTSLIIPDTLSLSEA
MEYFKNSRADFAVVMNEYALVVGIVTTNDLQRAVMGAWSLHESEEQIIARDSNSWLVDGV
TPITDVMRAFGIEEFPHNQNYETIAGFMMYMLRKIPKRTDFVNYAGYKFEVVDIDSYKVD
QLLVTRIDPIDKLNSPDV
Download sequence
Identical sequences 402882.Shew185_4012 WP_012090436.1.85636 gi|153002515|ref|YP_001368196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]