SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012106021.1.2930 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012106021.1.2930
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 1.14e-19
Family RBP11/RpoL 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012106021.1.2930
Sequence length 91
Comment DNA-directed RNA polymerase subunit L [Methanoregula boonei]; AA=GCF_000017625.1; RF=representative genome; TAX=456442; STAX=358766; NAME=Methanoregula boonei 6A8; strain=6A8; AL=Complete Genome; RT=Major
Sequence
MIVKVLELEKDKARLVIQGEGHTFMNALVEEILTDPDVDVAKYTIEFQFSDPELLVTTKN
AKKNPLTVIKKACKRISSNCDDLLKNLSKQK
Download sequence
Identical sequences A7I5J1
456442.Mboo_0484 WP_012106021.1.2930 gi|154150027|ref|YP_001403645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]