SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012106161.1.2930 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012106161.1.2930
Domain Number 1 Region: 10-245
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.54e-80
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000245
Further Details:      
 
Domain Number 2 Region: 252-360
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 1.94e-22
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012106161.1.2930
Sequence length 365
Comment DNA polymerase IV [Methanoregula boonei]; AA=GCF_000017625.1; RF=representative genome; TAX=456442; STAX=358766; NAME=Methanoregula boonei 6A8; strain=6A8; AL=Complete Genome; RT=Major
Sequence
MDGQTGDAGQRIVLHADMDCFYAAVEMHDHPEIAGKAVVVGADPQGGAGRGVVSTASYEA
RAFGVRSAMPISQAYRLCPGAVYLRPDMARYAAVSAEIMGIFKETGYRVQQVSIDEAFLD
ISPVRSFDTARDLAVRLKQTIRDRVGITCSLGVAPSKIVAKIASGHQKPDGMTVVTPDSA
RDFLAPLPIRKIPGIGGKTGAQIEALGITTIGNLATCDIQVLVGAFGRSAGLLREAALGH
DNSEVVERDGVKSISKETTFANDTEDPKEIAATMELLVREVAQAIADEALQFKTVTIRVR
YAGFVSKTKARSLLHYHNDEAAIRAAAGELLRELWDGKPIRRLGLRLSTLRHQDSRQQTL
FGSCR
Download sequence
Identical sequences A7I5X9
WP_012106161.1.2930 456442.Mboo_0622 gi|154150165|ref|YP_001403783.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]