SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012106183.1.2930 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012106183.1.2930
Domain Number 1 Region: 505-705
Classification Level Classification E-value
Superfamily PP2C-like 0.00000000017
Family PP2C-like 0.011
Further Details:      
 
Domain Number 2 Region: 405-455
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000000798
Family HAMP domain 0.0057
Further Details:      
 
Domain Number 3 Region: 166-249
Classification Level Classification E-value
Superfamily Sensory domain-like 0.000000133
Family Sensory domain of two-component sensor kinase 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012106183.1.2930
Sequence length 708
Comment serine phosphatase [Methanoregula boonei]; AA=GCF_000017625.1; RF=representative genome; TAX=456442; STAX=358766; NAME=Methanoregula boonei 6A8; strain=6A8; AL=Complete Genome; RT=Major
Sequence
MRIPGSWQRISIRTKILIVFLSLSMVALGILGYAAFSTMSDMGSYALTSSGQLGDRAVSD
STTALEANAEASLVRLATDQADISNVVFSQVDGEMDTLAGYAATVRAGPATTRPLYDQSE
RPQDPGSSSAYVLSPGVTRAGVENELYSLASLDDVMGPMLASDPRITQIYVGTGSGILYV
HPWLNTIPSSYDPRTRDWYIRAVQSGDLSWSDPYIDASGKGLMVTCSRPVPASTGNSTWV
VAADVTLSTVNAEIINTQIGDQGYAMLIDDRGNVIARPGISAGEKGWDESFEMENLLTSN
NSALAAVAQNMMAGQTGIARVPFSDGEKYVAYAPVKSVNWSVALVVPVDEVIAPAENTRG
QIVNATSDTGVHLNQTMNSAKGLFIALFVLLFVMVAGLSVLFSQVITRPVAALKRGSEAI
GAGDLGYRVEIHTGDEFEDLAHSFNTMAADLKEHMDELERTTAEKERFAKELEIAKGIQQ
SFLPDTAPDIAGIEIAAKNIPALEVGGDFYDFIPLGKDRWGLVIADVSGKGVPAALFMAL
SRTLIRASTLANADPAVAIGHANQLICEDSKTDMFVTLFYAILDSRAMTLDYVNAGHNPP
LLLKGTSSDVVLLKARGIALGLTDEMDLQSARMDLRPGDVLVLYTDGVTEAINDHEEEFG
EQRLLSVIMENRTLPAAELLEKILNAISTFAGNRPQHDDITLLILHAV
Download sequence
Identical sequences A7I600
WP_012106183.1.2930 gi|154150186|ref|YP_001403804.1| 456442.Mboo_0643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]