SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012106750.1.2930 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012106750.1.2930
Domain Number 1 Region: 3-76,166-340
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.26e-67
Family Bacterial dinuclear zinc exopeptidases 0.0000134
Further Details:      
 
Domain Number 2 Region: 66-174
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.11e-33
Family Aminopeptidase/glucanase lid domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012106750.1.2930
Sequence length 345
Comment peptidase M42 [Methanoregula boonei]; AA=GCF_000017625.1; RF=representative genome; TAX=456442; STAX=358766; NAME=Methanoregula boonei 6A8; strain=6A8; AL=Complete Genome; RT=Major
Sequence
MVKELLRKLSNAHGVSGSEGSVFALIKKELKGCVDEITEDPMGNLIAVRHGNKSKVMLAA
HMDEIGLMVKYIDDKGFLRFITLGGWYGPTLYNQRVIVHGTKGDRIGVIGGKPPHMMDED
ERKKGVKTDDMFIDIGAKNKDDVAELGIEVGTPVTIDREFTELANNRVTGKAFDNRAGVA
MLIKTMQKMKSPFTVYAVFTVQEEVGLKGAKTSAYTIDPDWAIATDVTIPGDHPGIDMKD
AAVEMGKGPVITIVDSSGRGLIASRKVVQWLKNAAETNAIPVQYEVGTGGTTDATSIHLS
RGGVPSTTISPPTRYIHSPVEVLDTGDIEAGVNLLVAALKTKPAL
Download sequence
Identical sequences A7I7K8
WP_012106750.1.2930 456442.Mboo_1201 gi|154150744|ref|YP_001404362.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]