SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012114822.1.63109 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012114822.1.63109
Domain Number 1 Region: 19-302
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1e-99
Family Methylenetetrahydrofolate reductase 0.0000000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012114822.1.63109
Sequence length 317
Comment methylenetetrahydrofolate reductase [NAD(P)H] [Xanthobacter autotrophicus]; AA=GCF_000017645.1; RF=representative genome; TAX=78245; STAX=280; NAME=Xanthobacter autotrophicus Py2; strain=Py2; AL=Complete Genome; RT=Major
Sequence
MTTPALAPAPAPVRASREMDRPPVKVSFEFFPPKSPEMEKTLWSSIARLAPLSPDFVSVT
YGAGGSTRERTHATVERIAKETDLAPAAHLTCVAATRDEIDAVVRAYGEAGVKHIVALRG
DPVTGVGTRYEPHPGGYAYANDLVAGIKRIGDFEVSVSAYPEKHPESASLDADIDVLKAK
VDAGATRAITQFFFENDVYFRYLDKVRARGIDIPIVPGILPVTNFKQASSFATRTGASVP
AWLLRRFEGLDDDVETRKLIAAAVAAEQVTDLVDRGVTDIHFYTLNRADLVYAICHLLGL
RPKVAGALADAPKAVAI
Download sequence
Identical sequences A7IJ78
WP_012114822.1.63109 78245.Xaut_2831 gi|154246770|ref|YP_001417728.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]