SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012123209.1.33635 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012123209.1.33635
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily Homeodomain-like 3.76e-25
Family Alr1493-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012123209.1.33635
Sequence length 75
Comment antitoxin [Ignicoccus hospitalis]; AA=GCF_000017945.1; RF=representative genome; TAX=453591; STAX=160233; NAME=Ignicoccus hospitalis KIN4/I; strain=KIN4/I; AL=Complete Genome; RT=Major
Sequence
MSEAEDRIVVNPKVMGGKPIIKGTRIPVYFILELLSNGWSIDDILREYPHLSREDVLAAI
KYAAKVLREKVIVKA
Download sequence
Identical sequences A8ABE3
453591.Igni_1068 WP_012123209.1.33635 gi|156937856|ref|YP_001435652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]