SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012123526.1.33635 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012123526.1.33635
Domain Number - Region: 120-164
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0125
Family FIS-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012123526.1.33635
Sequence length 169
Comment hypothetical protein [Ignicoccus hospitalis]; AA=GCF_000017945.1; RF=representative genome; TAX=453591; STAX=160233; NAME=Ignicoccus hospitalis KIN4/I; strain=KIN4/I; AL=Complete Genome; RT=Major
Sequence
MRLVWDYENGVVIDIETGEVVDYIVDFYVSEERFADKRVGSKISEEERALLKGTEIVKEL
NERGYRDVRGTFVQYKLGLTNKTVKSLEKVERLPEVPAELRTDFEYYLKLIERDPVLSAR
PKRSKHLMALVCAYVVNGKNVREVSKRYNVGEKTLRKLLALARERIIRT
Download sequence
Identical sequences A8ACB0
453591.Igni_1386 gi|156938173|ref|YP_001435969.1| WP_012123526.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]