SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012125431.1.38143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012125431.1.38143
Domain Number 1 Region: 90-146
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000759
Family NfeD domain-like 0.0084
Further Details:      
 
Weak hits

Sequence:  WP_012125431.1.38143
Domain Number - Region: 12-83
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00327
Family Rhomboid-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012125431.1.38143
Sequence length 151
Comment membrane protein [Cronobacter sakazakii]; AA=GCF_002094675.1; RF=na; TAX=28141; STAX=28141; NAME=Cronobacter sakazakii; strain=cro911C2-2; AL=Contig; RT=Major
Sequence
MMTLILSHPHVFWLCLGGLLLAAEMLGGNGFLLWSGVAAVATGLLTWLLPLGWEWQGVSF
ALFMLIAVWLWWRWLSRRAQPRPDNALNQRGQQLIGQRFMLTQSLENGRGQITVGDSVWP
VVASSDLPAGTVVEVVALDGIRLRVQASRTQ
Download sequence
Identical sequences A7MJY2
WP_012125431.1.34712 WP_012125431.1.360 WP_012125431.1.38143 WP_012125431.1.52367 WP_012125431.1.56053 WP_012125431.1.60338 WP_012125431.1.61601 WP_012125431.1.67391 WP_012125431.1.83282 WP_012125431.1.9447 gi|156934927|ref|YP_001438843.1| 290339.ESA_02776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]