SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012127414.1.11576 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012127414.1.11576
Domain Number - Region: 158-225
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.000769
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012127414.1.11576
Sequence length 261
Comment membrane protein [Vibrio campbellii]; AA=GCF_000017705.1; RF=representative genome; TAX=338187; STAX=680; NAME=Vibrio campbellii ATCC BAA-1116; strain=ATCC BAA-1116; BB120; AL=Complete Genome; RT=Major
Sequence
MEMIEPTMLLVLALVAFVAGFIDAVAGGGGMLTVPALLSLGLPPHIALGTNKLAASFASS
TAAFTYYRKRLFKPQCWGRAFLATLIGATLGTLFVDAISTEWLEKVLPLIILAAAMYTVF
HKTPQSTHQSPTPEPCPMLNKKQYAQGFTIGFYDGLAGPGTGAFWTVSSMALYRLNILLA
SGLAKAMNFTSNFTSLITFAVLGHINWVLGLTMGVCLMAGAFIGAHSAIRFGSKFIRPVF
VTVVSVLAIKLAYDAWFVGLA
Download sequence
Identical sequences A7N1M3
338187.VIBHAR_01556 WP_012127414.1.100291 WP_012127414.1.11576 gi|156973846|ref|YP_001444753.1| gi|538263016|gb|AGU94217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]