SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012127782.1.11576 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012127782.1.11576
Domain Number 1 Region: 14-343
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.24e-66
Family SAICAR synthase 0.0000932
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012127782.1.11576
Sequence length 367
Comment phosphoribosylaminoimidazolesuccinocarboxamide synthase [Vibrio campbellii]; AA=GCF_000017705.1; RF=representative genome; TAX=338187; STAX=680; NAME=Vibrio campbellii ATCC BAA-1116; strain=ATCC BAA-1116; BB120; AL=Complete Genome; RT=Major
Sequence
MSLANQVLAVNDDLPIRTHKPVHSGKVRSVYWLTEEDSARLIKEKGYDVAPDAPLAIMVI
SDRISAFDCIWHGEGGLKGVPGKGAALNAISNHWFKLFKDNGLADSHILDIPHPFVWIVQ
KAKPVKIEAICRKYITGSMWRAYANGEREFCGIELPEGLEKDKALPELLMTPSTKGILKG
IPGVPEADDVNITRQNIVDNFEAFNFSNAKDIAQYEKLLKEGFNVISSALEAIDQTFVDT
KFEFGYVHDAAGNEKLIYMDEVGTPDSSRIWDTKEYQAGNIVENSKEGFRQFLLSHFPDP
DILLNKERMPEREALARDNELPVESLMDISRTYIGIAEKITGQPIKLSNDPKAEIIEILS
KEYGLID
Download sequence
Identical sequences A7MVN0
338187.VIBHAR_02039 WP_012127782.1.100291 WP_012127782.1.11576 gi|538262825|gb|AGU94026.1| gi|156974324|ref|YP_001445231.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]