SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012131070.1.73367 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012131070.1.73367
Domain Number 1 Region: 11-221
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.3e-52
Family PP-loop ATPase 0.00049
Further Details:      
 
Domain Number 2 Region: 312-415
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000154
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012131070.1.73367
Sequence length 425
Comment MULTISPECIES: tRNA(Ile)-lysidine synthetase [Streptococcus]; AA=GCF_001589145.1; RF=na; TAX=1302; STAX=1302; NAME=Streptococcus gordonii; strain=FSS2; AL=Contig; RT=Major
Sequence
MIEQQFLKQCKEKAYFIEHQRVLLAISGGLDSMTLLNLLYKYQKELDIELILAHINHKQR
IEADQEEKQLKEIAQKLGVKILTSSFSGVFSEKSARDFRYNFFKKVMQEEDCTALVTAHH
ADDQAETIFMRILRGSRLRYLSGMKDRQPFGGGELIRPLLEFSKTDFPTVFHFEDASNFE
NTYFRNRVRNHYFPLLETENPRIKQAIINLGTEIAQLQKALSDLTKDLNQTDLQTFRKQK
REVQVFLLQEYLEKFPDLQLSKAQFDEILHILNTKANYHHYLKNQYELIQDYQTFKIQKI
GPKSDSKKDAILLQFEDIIELDNFCFSFGKELVGGVVQMIPVSRKTSIVLRHRQSGDRIV
LNGHHKKLARYFIDEKYSLQERDEAIIVEQFNEILGIAGIVTSDLSKNSKRDIMKDILYI
KKIDR
Download sequence
Identical sequences A8B000
gi|157150417|ref|YP_001451360.1| WP_012131070.1.24227 WP_012131070.1.30359 WP_012131070.1.30989 WP_012131070.1.42171 WP_012131070.1.45496 WP_012131070.1.50638 WP_012131070.1.69442 WP_012131070.1.73367 467705.SGO_2135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]