SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012155211.1.79101 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012155211.1.79101
Domain Number 1 Region: 290-462
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000612
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012155211.1.79101
Sequence length 486
Comment peptidase M48 [Shewanella pealeana]; AA=GCF_000018285.1; RF=representative genome; TAX=398579; STAX=70864; NAME=Shewanella pealeana ATCC 700345; strain=ATCC 700345; AL=Complete Genome; RT=Major
Sequence
MSKLTFSKSVIAGALSFILCTSSAVTYANNDLPDLGTAAVNTFSLEKETEVGDAYMRVIR
GSAPMLNDPVLNQYLTELGNKLVAHATGVKTPFYFFLLRNDEINAFAFFGGHVGVHTGLF
LNADTESELASVIGHEITHVTQRHLARSIEAQQKTSPATIAGMLGAILLTIASPQAGMAA
LATTQALATQSKINYTRLHEKEADRIGMQVMVDAGFDPNGAADFFGKLATRYRFTTKPPQ
MLLTHPLPESRISEARIRAEQYPHRQIPDNLNFQLAKARIQVRFSGYSEQAALSIFDKQL
KHHRYAFKSAAEYGKALALFRLKKYAESEKIIDELLAKSPNNLFFIDTKTDLLSQRGAQK
EAIELLLTQKQLKPTSQVVNTNLANVYIEDDQISKAIPLLEDLIFLDKQNQLPYFLLNEA
YKKNGNKAMEYFVKAESLALIADYKTAIDQLNFAYRESKDDPLQLARIEARIRQFRQADR
ALEQLQ
Download sequence
Identical sequences A8H406
398579.Spea_1971 WP_012155211.1.79101 gi|157961794|ref|YP_001501828.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]