SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012156802.1.79101 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012156802.1.79101
Domain Number 1 Region: 5-92
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000216
Family Anti-sigma factor antagonist SpoIIaa 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012156802.1.79101
Sequence length 97
Comment SpoIIAA family protein [Shewanella pealeana]; AA=GCF_000018285.1; RF=representative genome; TAX=398579; STAX=70864; NAME=Shewanella pealeana ATCC 700345; strain=ATCC 700345; AL=Complete Genome; RT=Major
Sequence
MVSFNQQGINCTVSGCLDQEAVRSLWNGRSSILDPDTAFLWLSEIEYCDSAGVAFLLELV
STFAAKGASLKLVSPSEQLKKFIILYDLNDFFIEEAK
Download sequence
Identical sequences A8H8N1
gi|157963419|ref|YP_001503453.1| 398579.Spea_3605 WP_012156802.1.79101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]