SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012160881.1.67183 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012160881.1.67183
Domain Number 1 Region: 3-104
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.12e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012160881.1.67183
Sequence length 124
Comment sulfate transporter [Acaryochloris marina]; AA=GCF_000018105.1; RF=representative genome; TAX=329726; STAX=155978; NAME=Acaryochloris marina MBIC11017; strain=MBIC11017; AL=Complete Genome; RT=Major
Sequence
MQQLPSFCIVHPPQHLTSTTQDVFYQHIYELVQSRVEVILINLETVTRLDSGGLGILFGA
FRISHRQGKRLMLYSPQSHVVQNLHKTGLTQIVGTYATLADCIKDAIPYSHRWVQDLSIQ
LPEF
Download sequence
Identical sequences B0C7K9
gi|158333411|ref|YP_001514583.1| WP_012160881.1.67183 329726.AM1_0183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]