SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012162316.1.67183 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012162316.1.67183
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily RbcX-like 4.84e-43
Family RbcX-like 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012162316.1.67183
Sequence length 133
Comment RbcX chaperonin protein [Acaryochloris marina]; AA=GCF_000018105.1; RF=representative genome; TAX=329726; STAX=155978; NAME=Acaryochloris marina MBIC11017; strain=MBIC11017; AL=Complete Genome; RT=Major
Sequence
MDQKRVAKDTAQVLISYLTYQAAKLVVTQLYETNPGLGIWLSEFSSTDRIQDGEFYLEAL
MQENRELALRLLTVREHLAEEVVEFLPEMVKTGIQESNVGHRRQLLERMTQMSTPESTSN
GDELEADADEELD
Download sequence
Identical sequences B0CCC0
gi|158334947|ref|YP_001516119.1| 329726.AM1_1784 WP_012162316.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]