SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012162970.1.67183 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012162970.1.67183
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 5.23e-37
Family N-terminal domain of MutM-like DNA repair proteins 0.00024
Further Details:      
 
Domain Number 2 Region: 141-231
Classification Level Classification E-value
Superfamily S13-like H2TH domain 4.32e-30
Family Middle domain of MutM-like DNA repair proteins 0.00091
Further Details:      
 
Domain Number 3 Region: 231-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.27e-18
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012162970.1.67183
Sequence length 284
Comment formamidopyrimidine-DNA glycosylase [Acaryochloris marina]; AA=GCF_000018105.1; RF=representative genome; TAX=329726; STAX=155978; NAME=Acaryochloris marina MBIC11017; strain=MBIC11017; AL=Complete Genome; RT=Major
Sequence
MPELPEVETVRLGLEKVTVGMQIMGGEVLYPRTIAHPQSPQVFIQGLQDATFLSWMRRGK
YLLSQLSFSTQQPSGWLGVHLRMTGQLLWVAQDEPVQKHTRVRLFFVNNRELRFVDQRTF
GQMWWVAPTEDPKQVISGLQKLGPEPFSEEFSVDYFWESLQGRKRSIKSALLDQALVAGV
GNIYADEALFMSEIRPTTACHQLQTEQVQRLRTAIIEVLSTSIGAGGTTFSDFRDLKGVN
GNYGGMAWVYGRQGQPCRTCGQTIERIKLVGRSTHFCPQCQPES
Download sequence
Identical sequences B0C5D4
gi|158335652|ref|YP_001516824.1| 329726.AM1_2501 WP_012162970.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]